PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 362aa    MW: 39697.5 Da    PI: 4.7
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010273genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT eEd++l +++   G g W++ ++  g++R++k+c++rw +yl
      Lus10010273 14 RGRWTSEEDQILTKYILDNGEGAWRSLPKNAGLKRCGKSCRLRWINYL 61
                     8*********************************************97 PP

2Myb_DNA-binding50.64.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + eEd+ +v+++  lG++ W++Ia++++ gRt++++k++w+++l
      Lus10010273  67 RGNISSEEDDVIVKLHSSLGNR-WSLIASYLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-20564IPR009057Homeodomain-like
PROSITE profilePS5129415.492961IPR017930Myb domain
SuperFamilySSF466893.75E-2711108IPR009057Homeodomain-like
SMARTSM007173.6E-101363IPR001005SANT/Myb domain
PfamPF002492.7E-121461IPR001005SANT/Myb domain
CDDcd001679.78E-81661No hitNo description
PROSITE profilePS5129423.80762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2365116IPR009057Homeodomain-like
SMARTSM007179.6E-1566114IPR001005SANT/Myb domain
PfamPF002497.7E-1467112IPR001005SANT/Myb domain
CDDcd001671.95E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRAPCCEKI GLKRGRWTSE EDQILTKYIL DNGEGAWRSL PKNAGLKRCG KSCRLRWINY  60
LRGDLKRGNI SSEEDDVIVK LHSSLGNRWS LIASYLPGRT DNEIKNYWNS HLGRKVHSCS  120
FRRLIGNEPE LKLVMDTSSK VGAVADGSKS KLLKSSSTKK GKAKKPVGGK GKIQDKAVVE  180
NLGSNEVPPL QKVPPSDENI RDRNAEEKQA MMVSETAPFS CISADGTIDD VELDFLDGLM  240
DSEITNGPFA LNEEGQSTVG NTADTIMGQL HDVDDGGSGP IKSCDDVDKI GSLEDSLECC  300
WPTTWSWEDV VVKGHEQLDD VVKFSNGDDD GLDLCKWSLD CEEIVGSSQE MDNDLVAWLL  360
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015891841.11e-72PREDICTED: transcription factor MYB12
SwissprotP278982e-69MYBP_MAIZE; Myb-related protein P
TrEMBLA0A0D2N9K25e-72A0A0D2N9K2_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.18e-70myb domain protein 12